| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Bacillus anthracis [TaxId:260799] [373248] (4 PDB entries) |
| Domain d6qo8b_: 6qo8 B: [373321] automated match to d4bmqa_ complexed with btb, fe2, so4 |
PDB Entry: 6qo8 (more details), 1.32 Å
SCOPe Domain Sequences for d6qo8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qo8b_ a.25.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 260799]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv
dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlngl
Timeline for d6qo8b_: