SCOPe 2.07: Domain d6qo9b_: 6qo9 B:

Lineage for d6qo9b_ (6qo9 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [373291] (6 PDB entries)

8. Domain d6qo9b_: 6qo9 B: [373313]
   automated match to d4bmqa_
   complexed with btb, mn, so4

Details for d6qo9b_

PDB Entry: 6qo9, 1.3 Å

PDB Description: crystal structure of ribonucleotide reductase nrdf from bacillus anthracis soaked with manganese ions

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d6qo9b_:

Sequence; same for both SEQRES and ATOM records:

>d6qo9b_ a.25.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv
dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr

Timeline for d6qo9b_:

• d6qo9b_ is new in SCOPe 2.07-stable
  
• d6qo9b_ appears in the current release, SCOPe 2.08