Lineage for d5zcza_ (5zcz A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560728Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2560878Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2560879Protein automated matches [191063] (9 species)
    not a true protein
  7. 2560917Species Thermus thermophilus [TaxId:300852] [373308] (1 PDB entry)
  8. 2560918Domain d5zcza_: 5zcz A: [373309]
    automated match to d2roea_

Details for d5zcza_

PDB Entry: 5zcz (more details)

PDB Description: solution structure of the t. thermophilus hb8 ttha1718 protein in living eukaryotic cells by in-cell nmr spectroscopy
PDB Compounds: (A:) Heavy metal binding protein

SCOPe Domain Sequences for d5zcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcza_ d.58.17.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mlklkvegmtcnhcvmavtkalkkvpgvekvevslekgealvegtadpkalvqaveeegy
kaevla

SCOPe Domain Coordinates for d5zcza_:

Click to download the PDB-style file with coordinates for d5zcza_.
(The format of our PDB-style files is described here.)

Timeline for d5zcza_: