Lineage for d6rbma1 (6rbm A:2-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692448Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 2692449Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)
  8. 2692473Domain d6rbma1: 6rbm A:2-67 [373305]
    Other proteins in same PDB: d6rbma2
    automated match to d1a6ia1
    complexed with cl, mg, miy; mutant

Details for d6rbma1

PDB Entry: 6rbm (more details), 2.05 Å

PDB Description: tetr(d) e147a mutant in complex with minocycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rbma1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOPe Domain Coordinates for d6rbma1:

Click to download the PDB-style file with coordinates for d6rbma1.
(The format of our PDB-style files is described here.)

Timeline for d6rbma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rbma2