Lineage for d1fwba_ (1fwb A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407171Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 407172Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 407173Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 407174Protein Urease, gamma-subunit [54113] (3 species)
  7. 407185Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 407189Domain d1fwba_: 1fwb A: [37330]
    Other proteins in same PDB: d1fwbb_, d1fwbc1, d1fwbc2
    complexed with ni; mutant

Details for d1fwba_

PDB Entry: 1fwb (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 6.5

SCOP Domain Sequences for d1fwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwba_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1fwba_:

Click to download the PDB-style file with coordinates for d1fwba_.
(The format of our PDB-style files is described here.)

Timeline for d1fwba_: