Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) |
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) |
Protein Urease, gamma-subunit [54113] (3 species) |
Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries) |
Domain d1fwba_: 1fwb A: [37330] Other proteins in same PDB: d1fwbb_, d1fwbc1, d1fwbc2 complexed with ni; mutant |
PDB Entry: 1fwb (more details), 2 Å
SCOP Domain Sequences for d1fwba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwba_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes} meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
Timeline for d1fwba_: