SCOPe 2.08: Domain d6rcra1: 6rcr A:2-67

Lineage for d6rcra1 (6rcr A:2-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)

8. Domain d6rcra1: 6rcr A:2-67 [373299]
   Other proteins in same PDB: d6rcra2
   automated match to d1a6ia1
   complexed with cl, dxt, mg; mutant

Details for d6rcra1

PDB Entry: 6rcr, 2.05 Å

PDB Description: tetr(d) h100a mutant in complex with doxycycline and magnesium

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rcra1:

Sequence; same for both SEQRES and ATOM records:

>d6rcra1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d6rcra1:

• d6rcra1 first appeared in SCOPe 2.07