Lineage for d6rgxa1 (6rgx A:3-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304932Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305157Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 2305158Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)
  8. 3073233Domain d6rgxa1: 6rgx A:3-67 [373295]
    Other proteins in same PDB: d6rgxa2, d6rgxa3, d6rgxb2, d6rgxb3
    automated match to d1a6ia1
    complexed with cl, dxt, mg, pg4, pge; mutant

Details for d6rgxa1

PDB Entry: 6rgx (more details), 1.8 Å

PDB Description: tetr(d) n82a mutant in complex with doxycycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rgxa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d6rgxa1:

Click to download the PDB-style file with coordinates for d6rgxa1.
(The format of our PDB-style files is described here.)

Timeline for d6rgxa1: