Lineage for d1fwaa_ (1fwa A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324865Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 324866Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 324867Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 324868Protein Urease, gamma-subunit [54113] (3 species)
  7. 324878Species Klebsiella aerogenes [TaxId:28451] [54114] (26 PDB entries)
  8. 324882Domain d1fwaa_: 1fwa A: [37329]
    Other proteins in same PDB: d1fwab_, d1fwac1, d1fwac2
    complexed with co3, ni; mutant

Details for d1fwaa_

PDB Entry: 1fwa (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 7.5

SCOP Domain Sequences for d1fwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwaa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1fwaa_:

Click to download the PDB-style file with coordinates for d1fwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fwaa_: