Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) |
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) |
Protein Urease, gamma-subunit [54113] (3 species) |
Species Klebsiella aerogenes [TaxId:28451] [54114] (26 PDB entries) |
Domain d1fwaa_: 1fwa A: [37329] Other proteins in same PDB: d1fwab_, d1fwac1, d1fwac2 complexed with co3, ni; mutant |
PDB Entry: 1fwa (more details), 2 Å
SCOP Domain Sequences for d1fwaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwaa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes} meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
Timeline for d1fwaa_: