SCOPe 2.07: Domain d6rgxb2: 6rgx B:68-208

Lineage for d6rgxb2 (6rgx B:68-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)

8. Domain d6rgxb2: 6rgx B:68-208 [373289]
   Other proteins in same PDB: d6rgxa1, d6rgxa3, d6rgxb1, d6rgxb3
   automated match to d2xpwa2
   complexed with cl, dxt, mg, pg4, pge; mutant

Details for d6rgxb2

PDB Entry: 6rgx, 1.8 Å

PDB Description: tetr(d) n82a mutant in complex with doxycycline and magnesium

PDB Compounds: (B:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rgxb2:

Sequence, based on SEQRES records:

>d6rgxb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records):

>d6rgxb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaallppllrealqimdsddgeqaflhgleslirgf
evqltallqiv

Timeline for d6rgxb2:

• d6rgxb2 is new in SCOPe 2.07-stable
  
• d6rgxb2 appears in the current release, SCOPe 2.08