Lineage for d6rgxb2 (6rgx B:68-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2334977Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2334978Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 3073227Domain d6rgxb2: 6rgx B:68-208 [373289]
    Other proteins in same PDB: d6rgxa1, d6rgxa3, d6rgxb1, d6rgxb3
    automated match to d2xpwa2
    complexed with cl, dxt, mg, pg4, pge; mutant

Details for d6rgxb2

PDB Entry: 6rgx (more details), 1.8 Å

PDB Description: tetr(d) n82a mutant in complex with doxycycline and magnesium
PDB Compounds: (B:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rgxb2:

Sequence, based on SEQRES records: (download)

>d6rgxb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d6rgxb2 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaallppllrealqimdsddgeqaflhgleslirgf
evqltallqiv

SCOPe Domain Coordinates for d6rgxb2:

Click to download the PDB-style file with coordinates for d6rgxb2.
(The format of our PDB-style files is described here.)

Timeline for d6rgxb2: