SCOPe 2.07: Domain d6rgxb1: 6rgx B:3-67

Lineage for d6rgxb1 (6rgx B:3-67)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)

8. Domain d6rgxb1: 6rgx B:3-67 [373288]
   Other proteins in same PDB: d6rgxa2, d6rgxa3, d6rgxb2, d6rgxb3
   automated match to d1a6ia1
   complexed with cl, dxt, mg, pg4, pge; mutant

Details for d6rgxb1

PDB Entry: 6rgx, 1.8 Å

PDB Description: tetr(d) n82a mutant in complex with doxycycline and magnesium

PDB Compounds: (B:) tetracycline repressor protein class d

SCOPe Domain Sequences for d6rgxb1:

Sequence; same for both SEQRES and ATOM records:

>d6rgxb1 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

Timeline for d6rgxb1:

• d6rgxb1 is new in SCOPe 2.07-stable
  
• d6rgxb1 appears in the current release, SCOPe 2.08