Lineage for d1ejta_ (1ejt A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407171Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 407172Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 407173Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 407174Protein Urease, gamma-subunit [54113] (3 species)
  7. 407185Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 407192Domain d1ejta_: 1ejt A: [37328]
    Other proteins in same PDB: d1ejtb_, d1ejtc1, d1ejtc2
    complexed with ni; mutant

Details for d1ejta_

PDB Entry: 1ejt (more details), 2 Å

PDB Description: crystal structure of the h219q variant of klebsiella aerogenes urease

SCOP Domain Sequences for d1ejta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejta_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1ejta_:

Click to download the PDB-style file with coordinates for d1ejta_.
(The format of our PDB-style files is described here.)

Timeline for d1ejta_: