Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.0: automated matches [254271] (1 protein) not a true family |
Protein automated matches [254628] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [371394] (47 PDB entries) |
Domain d5qs9a_: 5qs9 A: [373264] automated match to d5bqdb_ complexed with o0j |
PDB Entry: 5qs9 (more details), 1.43 Å
SCOPe Domain Sequences for d5qs9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qs9a_ b.2.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} elrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnh rwkyvngewvpggkpepqapscvyihpdspnfgahwmkapvsfskvkltnklngggqiml nslhkyeprihivrvgdpqrmitshcfpetqfiavtayqneeitalkikyn
Timeline for d5qs9a_: