SCOPe 2.08: Domain d6q6cb_: 6q6c B:

Lineage for d6q6cb_ (6q6c B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Conus striatus [TaxId:6493] [255085] (5 PDB entries)

8. Domain d6q6cb_: 6q6c B: [373261]
   automated match to d1yl2a_
   complexed with edo, no3, po4

Details for d6q6cb_

PDB Entry: 6q6c, 1.3 Å

PDB Description: pore-modulating toxins exploit inherent slow inactivation to block k+ channels

PDB Compounds: (B:) Kunitz-type conkunitzin-S1

SCOPe Domain Sequences for d6q6cb_:

Sequence; same for both SEQRES and ATOM records:

>d6q6cb_ g.8.1.0 (B:) automated matches {Conus striatus [TaxId: 6493]}
drpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqdtclyt

Timeline for d6q6cb_:

• d6q6cb_ first appeared in SCOPe 2.07