Lineage for d5qs8a_ (5qs8 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. Family b.2.5.0: automated matches [254271] (1 protein)
    not a true family
  6. Protein automated matches [254628] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [371394] (44 PDB entries)
  8. Domain d5qs8a_: 5qs8 A: [373252]
    automated match to d5bqdb_
    complexed with o0g

Details for d5qs8a_

PDB Entry: 5qs8 (more details), 1.47 Å

PDB Description: pandda analysis group deposition -- crystal structure of human brachyury g177d variant in complex with z1432018343
PDB Compounds: (A:) T-box transcription factor T

SCOPe Domain Sequences for d5qs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qs8a_ b.2.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnh
rwkyvngewvpggkpepqapscvyihpdspnfgahwmkapvsfskvkltnklngggqiml
nslhkyeprihivrvgdpqrmitshcfpetqfiavtayqneeitalkikyn

SCOPe Domain Coordinates for d5qs8a_ are not available.

Timeline for d5qs8a_: