Lineage for d1dx0a_ (1dx0 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. Protein Prion protein domain [54100] (14 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54104] (4 PDB entries)
  8. Domain d1dx0a_: 1dx0 A: [37324]

Details for d1dx0a_

PDB Entry: 1dx0 (more details)

PDB Description: bovine prion protein residues 23-230
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1dx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx0a_ d.6.1.1 (A:) Prion protein domain {Cow (Bos taurus) [TaxId: 9913]}
glggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnit
vkehtvttttkgenftetdikmmervveqmcitqyqresqayyq

SCOPe Domain Coordinates for d1dx0a_ are not available.

Timeline for d1dx0a_: