Lineage for d6orab_ (6ora B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923617Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2923618Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2923619Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2923620Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2923623Species Pyrococcus horikoshii [TaxId:70601] [319156] (12 PDB entries)
  8. 2923637Domain d6orab_: 6ora B: [373220]
    automated match to d1wzua1
    complexed with 5xr, 5xw, act, cl, sf4

Details for d6orab_

PDB Entry: 6ora (more details), 2.2 Å

PDB Description: an unexpected intermediate in the reaction catalyzed by quinolinate synthase
PDB Compounds: (B:) Quinolinate synthase A

SCOPe Domain Sequences for d6orab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6orab_ c.145.1.1 (B:) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
erakklhpnaklmihpqcipevqekadiiastggmikracewdewvvfteremvyrlrkl
ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems

SCOPe Domain Coordinates for d6orab_:

Click to download the PDB-style file with coordinates for d6orab_.
(The format of our PDB-style files is described here.)

Timeline for d6orab_: