| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (10 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries) |
| Domain d6agkd1: 6agk D:1-243 [373214] Other proteins in same PDB: d6agka2, d6agkb2, d6agkc2, d6agkd2, d6agke_, d6agkf1, d6agkf2 automated match to d4drxb1 complexed with 9wr, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 6agk (more details), 2.8 Å
SCOPe Domain Sequences for d6agkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6agkd1 c.32.1.1 (D:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
Timeline for d6agkd1: