Lineage for d1dwya_ (1dwy A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29966Fold d.6: Prion protein domain [54097] (1 superfamily)
  4. 29967Superfamily d.6.1: Prion protein domain [54098] (1 family) (S)
  5. 29968Family d.6.1.1: Prion protein domain [54099] (1 protein)
  6. 29969Protein Prion protein domain [54100] (4 species)
  7. 29970Species Cow (Bos taurus) [TaxId:9913] [54104] (4 PDB entries)
  8. 29971Domain d1dwya_: 1dwy A: [37321]

Details for d1dwya_

PDB Entry: 1dwy (more details)

PDB Description: bovine prion protein fragment 121-230

SCOP Domain Sequences for d1dwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwya_ d.6.1.1 (A:) Prion protein domain {Cow (Bos taurus)}
glggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnit
vkehtvttttkgenftetdikmmervveqmcitqyqresqayyq

SCOP Domain Coordinates for d1dwya_:

Click to download the PDB-style file with coordinates for d1dwya_.
(The format of our PDB-style files is described here.)

Timeline for d1dwya_: