Lineage for d1e1ja_ (1e1j A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597694Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 597695Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 597696Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 597697Protein Prion protein domain [54100] (12 species)
  7. 597715Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries)
  8. 597728Domain d1e1ja_: 1e1j A: [37320]
    mutant

Details for d1e1ja_

PDB Entry: 1e1j (more details)

PDB Description: human prion protein variant m166v

SCOP Domain Sequences for d1e1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ja_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens)}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpvdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr

SCOP Domain Coordinates for d1e1ja_:

Click to download the PDB-style file with coordinates for d1e1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1e1ja_: