Lineage for d6noka1 (6nok A:1-282)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529004Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2529005Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2529052Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2529053Protein automated matches [190655] (13 species)
    not a true protein
  7. 2529096Species Streptococcus pneumoniae [TaxId:1313] [369306] (4 PDB entries)
  8. 2529097Domain d6noka1: 6nok A:1-282 [373192]
    Other proteins in same PDB: d6noka2
    automated match to d1pzxb_
    complexed with myr, na

Details for d6noka1

PDB Entry: 6nok (more details), 1.69 Å

PDB Description: the x-ray crystal structure of streptococcus pneumoniae fatty acid kinase (fak) b1 protein loaded with myristic acid (c14:0) to 1.69 angstrom resolution
PDB Compounds: (A:) Fatty Acid Kinase (Fak) B1 protein

SCOPe Domain Sequences for d6noka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6noka1 c.119.1.0 (A:1-282) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
mklavftdssaylsaetlqredlfvldipvnidgeeyveginlsaeefyqkmaqaselpk
tsqpsiakldeiltslkeqgythalglflssgisgfyqsiqymvddyegltiafpdtlit
saplgimvesvfnwrdqgddfasiqdklaiqisrtsafimvddldhlvkggrlsngaail
gnllsikpilyfndqgvievyekvrtekkatkrlieiikettasgqyrvivihgnapeka
eelrqhlldfglgsdvslatfgsvigthlgagsialgyipvi

SCOPe Domain Coordinates for d6noka1:

Click to download the PDB-style file with coordinates for d6noka1.
(The format of our PDB-style files is described here.)

Timeline for d6noka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6noka2