| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
| Family d.6.1.1: Prion-like [54099] (3 proteins) |
| Protein Prion protein domain [54100] (13 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries) |
| Domain d1fkca_: 1fkc A: [37319] mutant |
PDB Entry: 1fkc (more details)
SCOPe Domain Sequences for d1fkca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkca_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftktdvkmmervveqmcitqyeresqayyqrgss
Timeline for d1fkca_: