Lineage for d6njfa1 (6njf A:10-64)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541749Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2541750Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2541775Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2541779Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)
  8. 2541807Domain d6njfa1: 6njf A:10-64 [373189]
    Other proteins in same PDB: d6njfa2
    automated match to d5ub0a_
    mutant

Details for d6njfa1

PDB Entry: 6njf (more details)

PDB Description: solution nmr structure of dancer3-f34a, a rigid and natively folded single mutant of the dynamic protein dancer-3
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d6njfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6njfa1 d.15.7.1 (A:10-64) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
tfkliingktlkgettteavdaataekvfkqyandngldgewtyddatktftite

SCOPe Domain Coordinates for d6njfa1:

Click to download the PDB-style file with coordinates for d6njfa1.
(The format of our PDB-style files is described here.)

Timeline for d6njfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6njfa2