Lineage for d6i9wa_ (6i9w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455692Species Ilumatobacter coccineus [TaxId:1313172] [338929] (4 PDB entries)
  8. 2455693Domain d6i9wa_: 6i9w A: [373186]
    automated match to d5o30b_
    complexed with bu3, cl; mutant

Details for d6i9wa_

PDB Entry: 6i9w (more details), 1.55 Å

PDB Description: crystal structure of the halohydrin dehalogenase hheg t123g mutant
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d6i9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i9wa_ c.2.1.0 (A:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]}
aenrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrg
advltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkag
nldmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravgleh
arhgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglld
gsnrfqtgqffdfsggwga

SCOPe Domain Coordinates for d6i9wa_:

Click to download the PDB-style file with coordinates for d6i9wa_.
(The format of our PDB-style files is described here.)

Timeline for d6i9wa_: