![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Atlantic cod (Gadus morhua) [TaxId:8049] [373131] (1 PDB entry) |
![]() | Domain d6hith_: 6hit H: [373163] automated match to d4esad_ complexed with hem |
PDB Entry: 6hit (more details), 2.5 Å
SCOPe Domain Sequences for d6hith_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hith_ a.1.1.2 (H:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]} ewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanplia ahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgsa ftvdtqvawqkflsvvvsalgrqy
Timeline for d6hith_: