Lineage for d6hitf_ (6hit F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688560Species Atlantic cod (Gadus morhua) [TaxId:8049] [373131] (1 PDB entry)
  8. 2688566Domain d6hitf_: 6hit F: [373152]
    automated match to d4esad_
    complexed with hem

Details for d6hitf_

PDB Entry: 6hit (more details), 2.5 Å

PDB Description: the crystal structure of haemoglobin from atlantic cod
PDB Compounds: (F:) Hemoglobin beta 4 chain

SCOPe Domain Sequences for d6hitf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hitf_ a.1.1.2 (F:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanpli
aahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgs
aftvdtqvawqkflsvvvsalgrqy

SCOPe Domain Coordinates for d6hitf_:

Click to download the PDB-style file with coordinates for d6hitf_.
(The format of our PDB-style files is described here.)

Timeline for d6hitf_: