Lineage for d6agxa_ (6agx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 3073084Domain d6agxa_: 6agx A: [373146]
    automated match to d3b2ta_
    complexed with 9wx

Details for d6agxa_

PDB Entry: 6agx (more details), 2.95 Å

PDB Description: the cocrystal structure of fgfr2 bound with compound 14 harboring 5h- pyrrolo[2,3-b]pyrazine scaffold
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d6agxa_:

Sequence, based on SEQRES records: (download)

>d6agxa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d6agxa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpinrvp
eeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfglardiykk
ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d6agxa_:

Click to download the PDB-style file with coordinates for d6agxa_.
(The format of our PDB-style files is described here.)

Timeline for d6agxa_:

  • d6agxa_ is new in SCOPe 2.07-stable