SCOPe 2.08: Domain d6i9ub_: 6i9u B:

Lineage for d6i9ub_ (6i9u B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Ilumatobacter coccineus [TaxId:1313172] [338929] (4 PDB entries)

8. Domain d6i9ub_: 6i9u B: [373145]
   automated match to d5o30b_
   mutant

Details for d6i9ub_

PDB Entry: 6i9u, 2.4 Å

PDB Description: crystal structure of the halohydrin dehalogenase hheg t123w mutant

PDB Compounds: (B:) Putative oxidoreductase

SCOPe Domain Sequences for d6i9ub_:

Sequence; same for both SEQRES and ATOM records:

>d6i9ub_ c.2.1.0 (B:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]}
enrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrga
dvltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkawn
ldmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravgleha
rhgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglldg
snrfqtgqffdfsggwga

Timeline for d6i9ub_:

• d6i9ub_ first appeared in SCOPe 2.07