Lineage for d6agkb1 (6agk B:1-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472270Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries)
  8. 2472323Domain d6agkb1: 6agk B:1-243 [373143]
    Other proteins in same PDB: d6agka2, d6agkb2, d6agkc2, d6agkd2, d6agke_, d6agkf1, d6agkf2
    automated match to d4drxb1
    complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agkb1

PDB Entry: 6agk (more details), 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6agkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agkb1 c.32.1.1 (B:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6agkb1:

Click to download the PDB-style file with coordinates for d6agkb1.
(The format of our PDB-style files is described here.)

Timeline for d6agkb1: