SCOPe 2.07: Domain d6agkb1: 6agk B:1-243

Lineage for d6agkb1 (6agk B:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries)

8. Domain d6agkb1: 6agk B:1-243 [373143]
   Other proteins in same PDB: d6agka2, d6agkb2, d6agkc2, d6agkd2, d6agke_, d6agkf1, d6agkf2
   automated match to d4drxb1
   complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agkb1

PDB Entry: 6agk, 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6agkb1:

Sequence; same for both SEQRES and ATOM records:

>d6agkb1 c.32.1.1 (B:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6agkb1:

• d6agkb1 is new in SCOPe 2.07-stable
  
• d6agkb1 appears in the current release, SCOPe 2.08