Lineage for d6i9ua_ (6i9u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847324Species Ilumatobacter coccineus [TaxId:1313172] [338929] (4 PDB entries)
  8. 2847339Domain d6i9ua_: 6i9u A: [373142]
    automated match to d5o30b_
    mutant

Details for d6i9ua_

PDB Entry: 6i9u (more details), 2.4 Å

PDB Description: crystal structure of the halohydrin dehalogenase hheg t123w mutant
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d6i9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i9ua_ c.2.1.0 (A:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]}
nrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrgad
vltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkawnl
dmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravglehar
hgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglldgs
nrfqtgqffdfsggwga

SCOPe Domain Coordinates for d6i9ua_:

Click to download the PDB-style file with coordinates for d6i9ua_.
(The format of our PDB-style files is described here.)

Timeline for d6i9ua_: