Lineage for d6hita_ (6hit A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (44 species)
    not a true protein
  7. 3073069Species Gadus morhua [TaxId:8049] [373131] (1 PDB entry)
  8. 3073075Domain d6hita_: 6hit A: [373137]
    automated match to d1xq5a_
    complexed with hem

Details for d6hita_

PDB Entry: 6hit (more details), 2.5 Å

PDB Description: the crystal structure of haemoglobin from atlantic cod
PDB Compounds: (A:) Hemoglobin alpha 2 chain

SCOPe Domain Sequences for d6hita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hita_ a.1.1.2 (A:) automated matches {Gadus morhua [TaxId: 8049]}
slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
qvhvavdkflaqlalalaekyr

SCOPe Domain Coordinates for d6hita_:

Click to download the PDB-style file with coordinates for d6hita_.
(The format of our PDB-style files is described here.)

Timeline for d6hita_:

  • d6hita_ is new in SCOPe 2.07-stable