Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein automated matches [190152] (25 species) not a true protein |
Species Escherichia coli [TaxId:562] [187107] (2 PDB entries) |
Domain d6ed7a1: 6ed7 A:2-429 [373133] Other proteins in same PDB: d6ed7a2, d6ed7b2, d6ed7c2, d6ed7d2, d6ed7e2, d6ed7f2, d6ed7g2, d6ed7h2 automated match to d1qj5a_ complexed with j4j, plp |
PDB Entry: 6ed7 (more details), 2.43 Å
SCOPe Domain Sequences for d6ed7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ed7a1 c.67.1.4 (A:2-429) automated matches {Escherichia coli [TaxId: 562]} ttddlafdqrhiwhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgynh pqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevamk malqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqsr mdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil liadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav qdetffcq
Timeline for d6ed7a1: