| Root: SCOPe 2.08 |
| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Atlantic cod (Gadus morhua) [TaxId:8049] [373131] (1 PDB entry) |
| Domain d6hite_: 6hit E: [373132] automated match to d1xq5a_ complexed with hem |
PDB Entry: 6hit (more details), 2.5 Å
SCOPe Domain Sequences for d6hite_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hite_ a.1.1.2 (E:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
qvhvavdkflaqlalalaekyr
Timeline for d6hite_: