Lineage for d6hite_ (6hit E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein automated matches [190359] (43 species)
    not a true protein
  7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [373131] (1 PDB entry)
  8. Domain d6hite_: 6hit E: [373132]
    automated match to d1xq5a_
    complexed with hem

Details for d6hite_

PDB Entry: 6hit (more details), 2.5 Å

PDB Description: the crystal structure of haemoglobin from atlantic cod
PDB Compounds: (E:) Hemoglobin alpha 2 chain

SCOPe Domain Sequences for d6hite_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hite_ a.1.1.2 (E:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
qvhvavdkflaqlalalaekyr

SCOPe Domain Coordinates for d6hite_ are not available.

Timeline for d6hite_:

Domains from other chains:
(mouse over for more information)
d6hita_, d6hitb_, d6hitc_, d6hitd_, d6hitf_, d6hitg_, d6hith_