SCOPe 2.07: Domain d6ecla1: 6ecl A:-1-429

Lineage for d6ecla1 (6ecl A:-1-429)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [311492] (3 PDB entries)

8. Domain d6ecla1: 6ecl A:-1-429 [373128]
   Other proteins in same PDB: d6ecla2, d6eclb_
   automated match to d2be2a1
   protein/RNA complex; complexed with mn, t90

Details for d6ecla1

PDB Entry: 6ecl, 2.39 Å

PDB Description: crystal structure of a 1,2,4-triazole allosteric rnase h inhibitor in complex with hiv reverse transcriptase

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6ecla1:

Sequence; same for both SEQRES and ATOM records:

>d6ecla1 e.8.1.2 (A:-1-429) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdi
viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
tpplvklwyql

Timeline for d6ecla1:

• d6ecla1 is new in SCOPe 2.07-stable
  
• d6ecla1 appears in the current release, SCOPe 2.08