SCOPe 2.08: Domain d6hafb2: 6haf B:183-365

Lineage for d6hafb2 (6haf B:183-365)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [373122] (1 PDB entry)

8. Domain d6hafb2: 6haf B:183-365 [373126]
   Other proteins in same PDB: d6hafa1, d6hafa3, d6hafb1, d6hafb3
   automated match to d2ez9a1
   complexed with fad, gol, k, mg, po4, tdp

Details for d6hafb2

PDB Entry: 6haf, 1.3 Å

PDB Description: pyruvate oxidase variant e59q from l. plantarum in complex with phosphate

PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d6hafb2:

Sequence; same for both SEQRES and ATOM records:

>d6hafb2 c.31.1.0 (B:183-365) automated matches {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

Timeline for d6hafb2:

• d6hafb2 first appeared in SCOPe 2.07