Lineage for d6hafb1 (6haf B:9-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865348Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries)
  8. 2865351Domain d6hafb1: 6haf B:9-182 [373125]
    Other proteins in same PDB: d6hafa2, d6hafb2
    automated match to d1powa2
    complexed with fad, gol, k, mg, po4, tdp

Details for d6hafb1

PDB Entry: 6haf (more details), 1.3 Å

PDB Description: pyruvate oxidase variant e59q from l. plantarum in complex with phosphate
PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d6hafb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hafb1 c.36.1.0 (B:9-182) automated matches {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhqevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

SCOPe Domain Coordinates for d6hafb1:

Click to download the PDB-style file with coordinates for d6hafb1.
(The format of our PDB-style files is described here.)

Timeline for d6hafb1: