Lineage for d6ed7f1 (6ed7 F:2-429)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2504021Protein automated matches [190152] (25 species)
    not a true protein
  7. 2504064Species Escherichia coli [TaxId:562] [187107] (2 PDB entries)
  8. 2504071Domain d6ed7f1: 6ed7 F:2-429 [373117]
    Other proteins in same PDB: d6ed7a2, d6ed7b2, d6ed7c2, d6ed7d2, d6ed7e2, d6ed7f2, d6ed7g2, d6ed7h2
    automated match to d1qj5a_
    complexed with j4j, plp

Details for d6ed7f1

PDB Entry: 6ed7 (more details), 2.43 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
PDB Compounds: (F:) 7,8-diamino-pelargonic acid aminotransferase

SCOPe Domain Sequences for d6ed7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ed7f1 c.67.1.4 (F:2-429) automated matches {Escherichia coli [TaxId: 562]}
ttddlafdqrhiwhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgynh
pqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevamk
malqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqsr
mdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil
liadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea
gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv
lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav
qdetffcq

SCOPe Domain Coordinates for d6ed7f1:

Click to download the PDB-style file with coordinates for d6ed7f1.
(The format of our PDB-style files is described here.)

Timeline for d6ed7f1: