Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins) automatically mapped to Pfam PF02668 |
Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (2 species) |
Species Escherichia coli [TaxId:83333] [373113] (1 PDB entry) |
Domain d6edhb_: 6edh B: [373114] automated match to d1otja_ complexed with 1pe, act, peg, pg4, sin, tau, vvo |
PDB Entry: 6edh (more details), 1.73 Å
SCOPe Domain Sequences for d6edhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6edhb_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 83333]} erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
Timeline for d6edhb_: