Lineage for d6agxd_ (6agx D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6agxd_: 6agx D: [373102]
    automated match to d3b2ta_
    complexed with 9wx

Details for d6agxd_

PDB Entry: 6agx (more details), 2.9499999999999997 Å

PDB Description: the cocrystal structure of fgfr2 bound with compound 14 harboring 5h- pyrrolo[2,3-b]pyrazine scaffold
PDB Compounds: (D:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d6agxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agxd_ d.144.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d6agxd_ are not available.

Timeline for d6agxd_:

Domains from other chains:
(mouse over for more information)
d6agxa_, d6agxb_, d6agxc_