SCOPe 2.08: Domain d6ebyc_: 6eby C:

Lineage for d6ebyc_ (6eby C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (8 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [372555] (2 PDB entries)

8. Domain d6ebyc_: 6eby C: [373100]
   automated match to d2gpfa1

Details for d6ebyc_

PDB Entry: 6eby, 1.85 Å

PDB Description: crystal structure of the mbth-like protein fsck bound to the interface forming region of fsch adenylation domain from thermobifida fusca

PDB Compounds: (C:) Conserved protein MbtH

SCOPe Domain Sequences for d6ebyc_:

Sequence; same for both SEQRES and ATOM records:

>d6ebyc_ d.100.2.0 (C:) automated matches {Thermobifida fusca [TaxId: 269800]}
npfdddegvflvlvndedqyslwpefaevpqgwrtvfgptsraaaldyinthwt

Timeline for d6ebyc_:

• d6ebyc_ first appeared in SCOPe 2.07