SCOPe 2.07: Domain d6eg5b1: 6eg5 B:1-243

Lineage for d6eg5b1 (6eg5 B:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (26 PDB entries)

8. Domain d6eg5b1: 6eg5 B:1-243 [373098]
   Other proteins in same PDB: d6eg5a2, d6eg5b2, d6eg5c2, d6eg5d2, d6eg5e_, d6eg5f1, d6eg5f2, d6eg5f3
   automated match to d4drxb1
   complexed with acp, ca, cl, gdp, gol, gtp, j7s, mes, mg

Details for d6eg5b1

PDB Entry: 6eg5, 2.45 Å

PDB Description: the structure of sb-1-202-tubulin complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6eg5b1:

Sequence; same for both SEQRES and ATOM records:

>d6eg5b1 c.32.1.1 (B:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6eg5b1:

• d6eg5b1 is new in SCOPe 2.07-stable
  
• d6eg5b1 appears in the current release, SCOPe 2.08