Lineage for d6agke_ (6agk E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2346954Protein Stathmin 4 [101496] (3 species)
  7. 2346971Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)
  8. 2347133Domain d6agke_: 6agk E: [373097]
    Other proteins in same PDB: d6agka1, d6agka2, d6agkb1, d6agkb2, d6agkc1, d6agkc2, d6agkd1, d6agkd2, d6agkf1, d6agkf2
    automated match to d4i55e_
    complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agke_

PDB Entry: 6agk (more details), 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6agke_:

Sequence, based on SEQRES records: (download)

>d6agke_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d6agke_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d6agke_:

Click to download the PDB-style file with coordinates for d6agke_.
(The format of our PDB-style files is described here.)

Timeline for d6agke_: