Lineage for d6aiqa_ (6aiq A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586270Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2586271Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2586272Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2586273Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2586309Species Thermochromatium tepidum [TaxId:1050] [57660] (11 PDB entries)
  8. 3073026Domain d6aiqa_: 6aiq A: [373088]
    automated match to d1iuaa_
    complexed with gol, sf4, so4

Details for d6aiqa_

PDB Entry: 6aiq (more details), 0.85 Å

PDB Description: high resolution structure of recombinant high-potential iron-sulfur protein
PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d6aiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aiqa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

SCOPe Domain Coordinates for d6aiqa_:

Click to download the PDB-style file with coordinates for d6aiqa_.
(The format of our PDB-style files is described here.)

Timeline for d6aiqa_:

  • d6aiqa_ is new in SCOPe 2.07-stable