Lineage for d6ebsa1 (6ebs A:1-312)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2415254Protein automated matches [190228] (21 species)
    not a true protein
  7. 2415303Species Leishmania major [TaxId:5664] [255853] (9 PDB entries)
  8. 3073024Domain d6ebsa1: 6ebs A:1-312 [373086]
    Other proteins in same PDB: d6ebsa2, d6ebsb2
    automated match to d2djxa_
    complexed with fmn, gol, ni, oro, so4; mutant

Details for d6ebsa1

PDB Entry: 6ebs (more details), 2.05 Å

PDB Description: crystal structure of leishmania major dihydroorotate dehydrogenase mutant h174a in complex with orotate
PDB Compounds: (A:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d6ebsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebsa1 c.1.4.1 (A:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfaafdaaae
ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr
cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq
tldefrgkvrtl

SCOPe Domain Coordinates for d6ebsa1:

Click to download the PDB-style file with coordinates for d6ebsa1.
(The format of our PDB-style files is described here.)

Timeline for d6ebsa1:

  • d6ebsa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ebsa2