Lineage for d1e1ua_ (1e1u A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29966Fold d.6: Prion protein domain [54097] (1 superfamily)
  4. 29967Superfamily d.6.1: Prion protein domain [54098] (1 family) (S)
  5. 29968Family d.6.1.1: Prion protein domain [54099] (1 protein)
  6. 29969Protein Prion protein domain [54100] (4 species)
  7. 29977Species Human (Homo sapiens) [TaxId:9606] [54103] (14 PDB entries)
  8. 29979Domain d1e1ua_: 1e1u A: [37308]

Details for d1e1ua_

PDB Entry: 1e1u (more details)

PDB Description: human prion protein variant r220k

SCOP Domain Sequences for d1e1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ua_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens)}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyekesqayyqr

SCOP Domain Coordinates for d1e1ua_:

Click to download the PDB-style file with coordinates for d1e1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1e1ua_: