Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [365483] (9 PDB entries) |
Domain d6pzmb_: 6pzm B: [373072] automated match to d2c07a1 |
PDB Entry: 6pzm (more details), 2.1 Å
SCOPe Domain Sequences for d6pzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pzmb_ c.2.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} ktalvtgasrgigraiaerlaqdgfyvivnyagnkahaqatvehiieqggqasaiqadva nehevsrlfqeakaingrldvvvhsagimpmakitpeslpdfdkvihtnlrgaflilaha aetvpdggriialstsviaksfpaygpyiaskagveglvhvlanelrgrnitvnavapgp tgtdlfyngktdeqvaaiaklaplerigtpdeiagvvamlagpdgrwvnsqvirvnggf
Timeline for d6pzmb_: