Lineage for d1e1pa_ (1e1p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928689Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2928690Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2928691Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2928692Protein Prion protein domain [54100] (14 species)
  7. 2928710Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries)
  8. 2928722Domain d1e1pa_: 1e1p A: [37307]

Details for d1e1pa_

PDB Entry: 1e1p (more details)

PDB Description: human prion protein variant s170n
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1e1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1pa_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeynnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr

SCOPe Domain Coordinates for d1e1pa_:

Click to download the PDB-style file with coordinates for d1e1pa_.
(The format of our PDB-style files is described here.)

Timeline for d1e1pa_: