Lineage for d6op1c_ (6op1 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912425Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2912426Species Azotobacter vinelandii [TaxId:354] [81398] (29 PDB entries)
  8. 2912440Domain d6op1c_: 6op1 C: [373069]
    Other proteins in same PDB: d6op1b_, d6op1d_
    automated match to d4xpia_
    complexed with ca, clf, cmo, hca, ics, imd, mg

Details for d6op1c_

PDB Entry: 6op1 (more details), 1.7 Å

PDB Description: selenium incorporated, carbon monoxide inhibited femo-cofactor of azotobacter vinelandii
PDB Compounds: (C:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d6op1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6op1c_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d6op1c_:

Click to download the PDB-style file with coordinates for d6op1c_.
(The format of our PDB-style files is described here.)

Timeline for d6op1c_: