SCOPe 2.08: Domain d6pznb_: 6pzn B:

Lineage for d6pznb_ (6pzn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [365483] (9 PDB entries)

8. Domain d6pznb_: 6pzn B: [373049]
   Other proteins in same PDB: d6pzna2, d6pznc2
   automated match to d2c07a1

Details for d6pznb_

PDB Entry: 6pzn, 2 Å

PDB Description: putative sdr from acinetobacter baumannii crystal form 2

PDB Compounds: (B:) 3-ketoacyl-ACP reductase

SCOPe Domain Sequences for d6pznb_:

Sequence; same for both SEQRES and ATOM records:

>d6pznb_ c.2.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
srktalvtgasrgigraiaerlaqdgfyvivnyagnkahaqatvehiieqggqasaiqad
vanehevsrlfqeakaingrldvvvhsagimpmakitpeslpdfdkvihtnlrgaflila
haaetvpdggriialstsviaksfpaygpyiaskagveglvhvlanelrgrnitvnavap
gptgtdlfyngktdeqvaaiaklaplerigtpdeiagvvamlagpdgrwvnsqvirvngg
f

Timeline for d6pznb_:

• d6pznb_ first appeared in SCOPe 2.07