SCOPe 2.07: Domain d6pe8l2: 6pe8 L:114-219

Lineage for d6pe8l2 (6pe8 L:114-219)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6pe8l2: 6pe8 L:114-219 [373043]
   Other proteins in same PDB: d6pe8b1, d6pe8l1
   automated match to d4rgne2
   complexed with so4

Details for d6pe8l2

PDB Entry: 6pe8, 2.84 Å

PDB Description: crystal structure of cd40/abbv-323 fab complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6pe8l2:

Sequence; same for both SEQRES and ATOM records:

>d6pe8l2 b.1.1.0 (L:114-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6pe8l2:

• d6pe8l2 is new in SCOPe 2.07-stable
  
• d6pe8l2 appears in the current release, SCOPe 2.08